SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R7V334 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R7V334
Domain Number 1 Region: 28-58
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.00000000314
Family Huristasin-like 0.0081
Further Details:      
 
Domain Number 2 Region: 1-27
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.00000000785
Family Huristasin-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R7V334
Sequence length 64
Comment (tr|R7V334|R7V334_CAPTE) Uncharacterized protein {ECO:0000313|EMBL:ELU12907.1, ECO:0000313|EnsemblMetazoa:CapteP69917} OX=283909 OS=Capitella teleta (Polychaete worm). GN=CAPTEDRAFT_69917 OC=Capitellida; Capitellidae; Capitella.
Sequence
CEEMVCSMHCENGFKVDSHGCNTCECYECPAIECRQFCSSGFKRDTHGCQTCECNEEPQT
CDEL
Download sequence
Identical sequences R7V334
jgi|Capca1|69917|gw1.16.126.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]