SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R8G7J2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R8G7J2
Domain Number 1 Region: 19-83
Classification Level Classification E-value
Superfamily delta-Endotoxin (insectocide), N-terminal domain 1.83e-17
Family delta-Endotoxin (insectocide), N-terminal domain 0.0009
Further Details:      
 
Weak hits

Sequence:  R8G7J2
Domain Number - Region: 80-137
Classification Level Classification E-value
Superfamily Fungal immunomodulatory protein, FIP 0.00536
Family Fungal immunomodulatory protein, FIP 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R8G7J2
Sequence length 153
Comment (tr|R8G7J2|R8G7J2_BACCE) Uncharacterized protein {ECO:0000313|EMBL:EOO56427.1} KW=Complete proteome OX=1053175 OS=Bacillus cereus BAG1X2-3. GN=ICM_05673 OC=Bacillus cereus group.
Sequence
MTPSTSKVSLNPSLIRPPSNTYEDAFLISIRLYSNYCVMHYSEGLNRIRSRGQSSNVWLD
FHSFRREMTLTVLDYVSLFTFFDTVRFPVPTTSRFLSELVISSGPLGFGVNPNRTHSWQG
NQNVNIFPSGDSFGLFTNRRTTIPGRNIFRVDS
Download sequence
Identical sequences A0A2C3LC49 R8DHH1 R8F3E8 R8G7J2 R8JRZ7
WP_016083933.1.22152 WP_016083933.1.60255 WP_016083933.1.79549 WP_016083933.1.94914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]