SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R9AKQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R9AKQ6
Domain Number 1 Region: 4-106
Classification Level Classification E-value
Superfamily Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.0000000000000162
Family Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R9AKQ6
Sequence length 178
Comment (tr|R9AKQ6|R9AKQ6_WALI9) Uncharacterized protein {ECO:0000313|EMBL:EOR00666.1} KW=Complete proteome; Reference proteome OX=1299270 OS=Wallemia ichthyophaga (strain EXF-994 / CBS 113033). GN=J056_000476 OC=Wallemiomycetes; Wallemiales; Wallemiales incertae sedis; Wallemia.
Sequence
MAPHVQPSEFLRDLAELFERVSGSVSSGSGSGTVFLTQKRYQYHDKEGAEMDIDADSPNP
AQFHVLLRATAQIDDKQYKSATRIPSDQLDGFVAHYNSLLHAHLHSNLRKRDRKREKRKA
DIAAVRKRRLETPVDIPHSKRGSGRRKFQRKVKAEQRRLAALHTVASGTSGQNTLKIP
Download sequence
Identical sequences R9AKQ6
XP_009268379.1.93709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]