SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R9BA00 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R9BA00
Domain Number 1 Region: 89-264
Classification Level Classification E-value
Superfamily Aerolisin/ETX pore-forming domain 4.71e-18
Family ETX/MTX2 0.015
Further Details:      
 
Weak hits

Sequence:  R9BA00
Domain Number - Region: 37-75
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 0.0275
Family Ribosomal protein L9 C-domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R9BA00
Sequence length 287
Comment (tr|R9BA00|R9BA00_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:EOR09216.1} KW=Complete proteome OX=1217699 OS=Acinetobacter sp. CIP 110321. GN=F896_01068 OC=Moraxellaceae; Acinetobacter.
Sequence
MSVKHLDKLYLRSLLTDFWKKELNTNKDPANGKWYEKGAQNDGGLYGDVSDADDVEIIFH
QDQAKLEKNQVTIIHSDFDNSKSNIGTEFSTELSDTCTLAKTHTTTKSHTIKFGLGYEVK
AKVGIVFVDVEETIKVNFEYQYATSKTESTTESSSQTIKQTIKCIVPAGKIYRASLVCTK
QRLLIPFTALIAFKGTTGTWFESRVDNHYHWISSIGHAFQQINAKKLAGNDSERFTVRGI
EDKGMMDNSQQFDFKIIISDITNLVNLGNVEKLIEKEENFVELVELA
Download sequence
Identical sequences R9BA00
WP_016162910.1.2649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]