SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R9RG67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R9RG67
Domain Number - Region: 72-170
Classification Level Classification E-value
Superfamily Hsp90 co-chaperone CDC37 0.0484
Family Hsp90 co-chaperone CDC37 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R9RG67
Sequence length 195
Comment (tr|R9RG67|R9RG67_9CAUD) Uncharacterized protein {ECO:0000313|EMBL:AGM47147.1} KW=Complete proteome OX=1300007 OS=Alteromonas phage vB_AmaP_AD45-P4. GN=AD45P4_00460 OC=Viruses; dsDNA viruses, no RNA stage; Caudovirales; Podoviridae.
Sequence
MSGELGLRPTDMARSEYLSLDTGVGNLLAHDIVEHINGISAIGTVTDELEALAVVMIVRN
NYAAVVTEEDLAYDVIECFRYYNPKTKAPVTHKHKIFEDAIEQILDLATEKVSSEIDDYC
AETWERFRYLARAHMRIGTRKFFKKYPSNCAEAEAYETFCSIQKAVQNTEIYDGARYQLN
VVDTVCTIHSLYEDY
Download sequence
Identical sequences R4W107 R9RG67 R9RGT6 R9RHD0
WP_037189824.1.69812 YP_008126068.1.36693 gi|514051641|ref|YP_008126068.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]