SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S0GIA3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  S0GIA3
Domain Number - Region: 7-50
Classification Level Classification E-value
Superfamily MAST3 pre-PK domain-like 0.0366
Family MAST3 pre-PK domain-like 0.01
Further Details:      
 
Domain Number - Region: 102-180
Classification Level Classification E-value
Superfamily delta-Endotoxin (insectocide), middle domain 0.0889
Family delta-Endotoxin (insectocide), middle domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) S0GIA3
Sequence length 196
Comment (tr|S0GIA3|S0GIA3_9BACT) Uncharacterized protein {ECO:0000313|EMBL:EOS17599.1} KW=Complete proteome; Reference proteome OX=1235789 OS=Parabacteroides goldsteinii dnLKV18. GN=C803_02611 OC=Parabacteroides.
Sequence
MRTETRTYTLYQITELSEEAKEKAHNEWLYSRYFYGWTNENRQTLDTFCERFGIVCRNWR
YDACNYSYDYRSRQEDCIDGLSGWRLATYLMNHHWNDLCTPKYFWKGMKGRKSRIFVDTC
CPLTGYYIDDCILDPIYKFLKSPTENVTFDDLMNDCLDSFFRACRDDMESTQTLEYFTEE
SNANNWEYLSDGNLFN
Download sequence
Identical sequences S0GIA3
WP_010802177.1.45416 WP_010802177.1.51638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]