SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S1P0Y6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  S1P0Y6
Domain Number - Region: 183-217
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 0.0889
Family Small-conductance potassium channel 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S1P0Y6
Sequence length 294
Comment (tr|S1P0Y6|S1P0Y6_9ENTE) Major capsid protein {ECO:0000313|EMBL:EOT38257.1} KW=Complete proteome; Reference proteome OX=1139219 OS=Enterococcus dispar ATCC 51266. GN=OMK_02525 OC=Enterococcus.
Sequence
MAIKYYTKQYAGMLPNLFAKKAAFLRSFGGALQVKDGISQKDTFMELKTSDTDVVIQAYS
TDPNVGFGTSTGNTSRFGPRKEVKSVDVEVGYEAPLAINEGIDDFTVNDIPEQVVAERLG
LHGVAWAQHVDGLLGKAISDNASETLTGELTEAGVTKLFADAHKKFVNNGVSDAIAHVAY
VTADVLNFLIDSDLAKTDKNSSANVDEQTLYKFKGFNLIELPDAKFQTGENTYFVADSVG
VAGVGIQVARAMDSEDFAGTALQAAAKYGKYIPEANKKAILKATLTEPEEVPAG
Download sequence
Identical sequences S1P0Y6
WP_016173634.1.24271 WP_016173634.1.39013 WP_016173634.1.53451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]