SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S2L171 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  S2L171
Domain Number - Region: 50-160
Classification Level Classification E-value
Superfamily IpaD-like 0.00288
Family IpaD-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) S2L171
Sequence length 250
Comment (tr|S2L171|S2L171_LACDL) IS66 family element, transposase {ECO:0000313|EMBL:EPB98680.1} KW=Complete proteome OX=1269760 OS=Lactobacillus delbrueckii subsp. lactis CRL581. GN=G134_1834 OC=Lactobacillus.
Sequence
MRKELLKQDVIHADETPYRVLDSERAKDYVWTLLSGKHAEKQIVLYNHGSRKGAEAWDFL
AGFMINILPKDKAIESDATLVANQGINYCSQMFSLERAWEDLSAEERYEKRQSELKPLLE
KFSDWCSKKSISVLPSGKQGTAFKYCMKHMDKFMNALKDSRLELSNNRAERAVKEIVMGR
KNWLFSQSSTGAKSMAIIMSILETAKQNGLDQFKYINYLLDKPPNELSFSVWKPIYHGLR
MSSSTVNKVP
Download sequence
Identical sequences S2L171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]