SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S3HD09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  S3HD09
Domain Number - Region: 10-36
Classification Level Classification E-value
Superfamily Neurophysin II 0.0157
Family Neurophysin II 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) S3HD09
Sequence length 54
Comment (tr|S3HD09|S3HD09_9RHIZ) Uncharacterized protein {ECO:0000313|EMBL:EPE96579.1} KW=Complete proteome; Reference proteome OX=990285 OS=Rhizobium grahamii CCGE 502. GN=RGCCGE502_19475 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MGLREQRGERTFGCKIGFTNRTICPSTMWCMTPCGATIWGYMYDKTVFDLAARD
Download sequence
Identical sequences S3HD09

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]