SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S4GRK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  S4GRK8
Domain Number - Region: 2-42
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 0.0112
Family Clostridium neurotoxins, "coiled-coil" domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S4GRK8
Sequence length 60
Comment (tr|S4GRK8|S4GRK8_GARVA) Uncharacterized protein {ECO:0000313|EMBL:EPI49048.1} KW=Complete proteome OX=1261066 OS=Gardnerella vaginalis JCP8108. GN=HMPREF1581_00404 OC=Gardnerella.
Sequence
MILWKIDNNTYKHVNNISKFIAKYFYNIFINNFQNKELDQLKCVMQFKTDLIVLSHVINI
Download sequence
Identical sequences S4GRK8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]