SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S4NVQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  S4NVQ0
Domain Number - Region: 72-142
Classification Level Classification E-value
Superfamily Aerolisin/ETX pore-forming domain 0.00693
Family ETX/MTX2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) S4NVQ0
Sequence length 222
Comment (tr|S4NVQ0|S4NVQ0_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:EPJ42614.1} KW=Complete proteome; Reference proteome OX=1283301 OS=Streptomyces afghaniensis 772. GN=STAFG_0335 OC=Streptomyces.
Sequence
MTKNRTLRYGSRTLALTATALGVIATAVPAAAEEQPTAEQIMADCASGEGKCTFNSPQIG
RAYLGEPRQVSELLYNCTDSPASQSMSWADTVGSSHSVGGSVTAGGGIEGIITASVTATY
NYTWQSSHTETSSFTVNVRPGEVGWISRAQVMQQITGTWQTHYDDPKWGHYYWFVPDVVT
GPAPNGTDGKHSAVVVKSRKMTPEEKKLCSTGSTQDKLFTRS
Download sequence
Identical sequences S4NVQ0
WP_020269363.1.76605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]