SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S4RQV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  S4RQV1
Domain Number - Region: 7-76
Classification Level Classification E-value
Superfamily Gamma-glutamyl cyclotransferase-like 0.000562
Family Gamma-glutamyl cyclotransferase-like 0.02
Further Details:      
 
Domain Number - Region: 82-135
Classification Level Classification E-value
Superfamily MAST3 pre-PK domain-like 0.00379
Family MAST3 pre-PK domain-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) S4RQV1
Sequence length 137
Comment (tr|S4RQV1|S4RQV1_PETMA) Gamma-glutamylcyclotransferase {ECO:0000256|RuleBase:RU363081} OX=7757 OS=Petromyzon marinus (Sea lamprey). GN= OC=Hyperoartia; Petromyzontiformes; Petromyzontidae; Petromyzon.
Sequence
QPGRVVTLVKDPGNSVWGVAYKIRDDLREDVKRTLDIREQGGYNTSFVMFYPREVENEPF
LSMLYVGTEDNPNFLGPAPMEEIAQQILMSSGPSGQNTEYLFELANTMRRLVPEAPDQHL
YTLEEMVRELLIFCSSS
Download sequence
Identical sequences S4RQV1
ENSPMAP00000007587 ENSPMAP00000007587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]