SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S5Z9D0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  S5Z9D0
Domain Number - Region: 569-632
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00031
Family Cna protein B-type domain 0.021
Further Details:      
 
Domain Number - Region: 78-220
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.00651
Family Complement components 0.058
Further Details:      
 
Domain Number - Region: 495-557
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0153
Family Carboxypeptidase regulatory domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) S5Z9D0
Sequence length 652
Comment (tr|S5Z9D0|S5Z9D0_9CREN) Uncharacterized protein {ECO:0000313|EMBL:AGT35975.1} KW=Complete proteome; Reference proteome OX=1365176 OS=Thermofilum adornatus. GN=N186_08185 OC=Thermofilum.
Sequence
MARGPTEKMIAAMLVLLLVVYTQTSTVTHHVAVEVKAEPLVDWLELARSAWNYFQPGVGL
SSLGLNYASISWHYLTDWDLGCYISAIVDAEALGLVDKEGTMGSDARIRKVLNFLATRPL
HPSGVPYGVYDADTGEPGTTSPSNPSDAGRLLIALYRLKQHRPEFSNYIDYVVERNGMLK
FAGGVPNNGFYSYYYAYGYYLWGARTRQVNDALNVLSTLRSKQVVDAYGVKLPFVEITME
PILYSIFELSLPEDFFYWANLTLQAQFNRYKATGKLTAFTEGNLAVPPYYIYEWIVDIYT
GKTFTLWSPSMGHTSLTPVVFTKAAIGMHAIWENEYTSLLLNYVMKAKTPNGFYEGVDEN
GNIIYIMTDKTNSLIINAARYALQKAKPPSLVVQETLETFPGESVTLPVLVNHSLSLPVH
LNVSSGIEGLTLSLQNSSGKTPLKTNLTITVYNMIRPGSYQVIILATSPLAKPVNRTLTV
IVKPPGYTLKIKALNACGEPASNVTIVLGDFKGLTARDGTLTFRHLNGTYMLYAFLGRVQ
VADPTTITISSDTELTLKLKLYKVLIDAKTTKGTPAEGIILRAFVDDQFLSYAKTNSSGL
AVLKNIPPGNITVKAYSSDGKIELGSWSITVRGDVDVVDPEIVVPEIGKIEA
Download sequence
Identical sequences S5Z9D0
WP_020963282.1.19067 gi|530781180|ref|YP_008432988.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]