SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S6H8K7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  S6H8K7
Domain Number - Region: 32-60
Classification Level Classification E-value
Superfamily Hypothetical protein c14orf129, hspc210 0.00458
Family Hypothetical protein c14orf129, hspc210 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) S6H8K7
Sequence length 85
Comment (tr|S6H8K7|S6H8K7_9PSED) Uncharacterized protein {ECO:0000313|EMBL:EPJ86258.1} KW=Complete proteome OX=911242 OS=Pseudomonas sp. CFII64. GN=CFII64_10624 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSEIEQCVLACNDCAGLFRLGRSVEAALNMLEVFETADGLLERNSPAVRQQWSQLLVEML
ACQQSQDWLGLADYMQYELTELVHS
Download sequence
Identical sequences S6H8K7
WP_020290745.1.32710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]