SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S7MSU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S7MSU9
Domain Number 1 Region: 9-110
Classification Level Classification E-value
Superfamily Oncogene products 8.63e-24
Family Oncogene products 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S7MSU9
Sequence length 111
Comment (tr|S7MSU9|S7MSU9_MYOBR) T-cell leukemia/lymphoma protein 1A {ECO:0000313|EMBL:EPQ07479.1} KW=Complete proteome; Reference proteome OX=109478 OS=Myotis brandtii (Brandt's bat). GN=D623_10001118 OC=Vespertilionidae; Myotis.
Sequence
MAELPSKVHLTSHPKCLRIRGHLVYEDEKHRTWLHLVMDTGVLHVRLRQEDIPSRHIALS
TSPLTLSTMPWMWTLHSGSQYVDPMGRFWRILHHVKENGVEEMILELMEDS
Download sequence
Identical sequences S7MSU9
XP_005865826.1.60319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]