SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S7P8F6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S7P8F6
Domain Number 1 Region: 9-111
Classification Level Classification E-value
Superfamily Oncogene products 8.24e-24
Family Oncogene products 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) S7P8F6
Sequence length 112
Comment (tr|S7P8F6|S7P8F6_MYOBR) Protein p13 MTCP-1 {ECO:0000313|EMBL:EPQ06463.1} KW=Complete proteome; Reference proteome OX=109478 OS=Myotis brandtii (Brandt's bat). GN=D623_10001145 OC=Vespertilionidae; Myotis.
Sequence
MAELPSILHLTSHPICLRIRGPSVYEDDKKRTWLHLVMETGGVLQVRLRQEDIPSGHIAL
TTRPKTSSTMLFMWTLQPGDQYLDSMCRFWRIVHHIKENGVEEMILELMEDS
Download sequence
Identical sequences S7P8F6
XP_005864213.1.60319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]