SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S7S2V9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  S7S2V9
Domain Number - Region: 47-94
Classification Level Classification E-value
Superfamily MukF C-terminal domain-like 0.0589
Family MukF C-terminal domain-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) S7S2V9
Sequence length 252
Comment (tr|S7S2V9|S7S2V9_GLOTA) Uncharacterized protein {ECO:0000313|EMBL:EPQ60134.1} KW=Complete proteome; Reference proteome OX=670483 OS=(Brown rot fungus). GN=GLOTRDRAFT_134880 OC=Agaricomycetes; Gloeophyllales; Gloeophyllaceae; Gloeophyllum.
Sequence
MLSLLSRTTSRLLDVRFDPSDSPYSQEEDILTVDLDALRELVPGKPNIPWRRVVGACEET
LFPVYRKLQDTLSHDVDHLAHLFSEMGTSVMEESSQKLEEISEAACVSGVATTSDTRRAF
ASCSPSHRKRRRSSHSGAAEILVIPSTHPSAPTIIITFCPYEPYESTSWVPCQDACFGNR
LSVPNHPAVNDAFPPLLAEPLPASLRPVEKWQYTNGHWCAVLPTLEEQARRGLCSRVIPV
RRKARAPRRGKR
Download sequence
Identical sequences S7S2V9
XP_007860609.1.11637 jgi|Glotr1_1|134880|estExt_Genemark1.C_00001_t10198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]