SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S9RV84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  S9RV84
Domain Number - Region: 37-108
Classification Level Classification E-value
Superfamily ImpE-like 0.00562
Family ImpE-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) S9RV84
Sequence length 142
Comment (tr|S9RV84|S9RV84_9RALS) Uncharacterized protein {ECO:0000313|EMBL:EPX96188.1} KW=Complete proteome OX=1235457 OS=Ralstonia sp. AU12-08. GN=C404_19685 OC=Burkholderiaceae; Ralstonia.
Sequence
MSLFASQRIRNRFEDVSEHARRALNGTSAAVNHARHAARPAVEDVQSLLHSLEDAIEALA
DEGSAEASRARRTLRARADALRHTANDRAHQARERMDWALGRTQETISAAPFKSIGVAVA
IGAAIGLVVALAGGGSRRAEAE
Download sequence
Identical sequences A0A100HTQ2 A0A191ZSS7 S9RV84
WP_021196247.1.28133 WP_021196247.1.33042 WP_021196247.1.52498 WP_021196247.1.60203 WP_021196247.1.99194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]