SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S9VYC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S9VYC7
Domain Number 1 Region: 176-333
Classification Level Classification E-value
Superfamily Functional domain of the splicing factor Prp18 2.22e-44
Family Functional domain of the splicing factor Prp18 0.00025
Further Details:      
 
Domain Number 2 Region: 112-158
Classification Level Classification E-value
Superfamily PRP4-like 0.000000000111
Family PRP4-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S9VYC7
Sequence length 343
Comment (tr|S9VYC7|S9VYC7_SCHCR) U5 snRNP-associated protein Prp18 {ECO:0000313|EMBL:EPY51264.1} KW=Complete proteome; Reference proteome OX=653667 OS=11777 / NBRC 106824 / NRRL Y48691) (Fission yeast). GN=SPOG_02440 OC=Schizosaccharomycetaceae; Schizosaccharomyces.
Sequence
MKMDFLKEEIEKKRRQLEGKNDIPAKKAFRRGDWEKERERKYLEEQREMELKKEEKKRKL
DEEKESYEKERLQSISKIAKVDEALSPSSPVVTGTAESPRVSESQISTKSTSPSTRGEHS
DLPHSEVIRKLREMKEPIKLFGESEEALVKRFFKIQKEKQVEQLEQDLLSRGVELIEYQR
ASIEKPRISKQVVTFLRRGIYVWDKILISKPITEQNNPEGQGQLKIFRQAKQDLETLIRL
LIDGALNDDIFSKIAEICYRCQRKEFVKANDVYLQLTIGNAPWPIGVTMVGIHERSAHQR
LKRDPNTNILKDEKKRKCLQALKRFITFSEREDPDWFSEKDSS
Download sequence
Identical sequences S9VYC7
XP_013023835.1.62511 EPY51264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]