SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T0CR16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  T0CR16
Domain Number - Region: 33-79
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 0.0288
Family RecG, N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T0CR16
Sequence length 84
Comment (tr|T0CR16|T0CR16_PAESO) Uncharacterized protein {ECO:0000313|EMBL:EPZ59970.1} KW=Complete proteome; Reference proteome OX=1292036 OS=Paeniclostridium sordellii ATCC 9714. GN=H477_0803 OC=Peptostreptococcaceae; Paeniclostridium.
Sequence
MRIAINLLDTADLTNDSNYERLNVFYKTAVERIQGIEVSKDEQAHIDWIKEAANEIESKM
YYINRVRHEVIELIQYLKLLGKIL
Download sequence
Identical sequences T0CR16

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]