SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T0SM01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  T0SM01
Domain Number - Region: 25-65
Classification Level Classification E-value
Superfamily Proteasome activator 0.0811
Family Proteasome activator 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T0SM01
Sequence length 127
Comment (tr|T0SM01|T0SM01_LACFE) Uncharacterized protein {ECO:0000313|EMBL:EQC59762.1} KW=Complete proteome OX=1366052 OS=Lactobacillus fermentum MTCC 8711. GN=N219_00260 OC=Lactobacillus.
Sequence
MAERVGIGLDLDPQLAAGYELLQGAMTALEEHDVDQLMDLLFTKWDVPAPFQTVLKTLRK
NSEGVYNATVLPYSNGRVEGINRMIKLIQRTAYGFTNFGHFIARIRLHQMGTEAEKRRRQ
VQAPAAA
Download sequence
Identical sequences T0SM01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]