SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T0XUQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  T0XUQ6
Domain Number - Region: 2-48
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 0.0379
Family A middle domain of Talin 1 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T0XUQ6
Sequence length 56
Comment (tr|T0XUQ6|T0XUQ6_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:EQD26516.1} OX=410659 OS=mine drainage metagenome. GN=B1B_19551 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
MSTALSEVSTALSEVSTALSEVGASDDDESPEDTINQIMEARKMLSNASYFAFTAT
Download sequence
Identical sequences T0XUQ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]