SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1DVP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  T1DVP2
Domain Number - Region: 11-48
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 0.0445
Family Small-conductance potassium channel 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T1DVP2
Sequence length 49
Comment (tr|T1DVP2|T1DVP2_9HELI) Uncharacterized protein {ECO:0000313|EMBL:GAD18732.1} KW=Complete proteome; Reference proteome OX=1325130 OS=Helicobacter fennelliae MRY12-0050. GN=HFN_2144 OC=Helicobacteraceae; Helicobacter.
Sequence
MQKCAPNASFKAGKKISFGASKSALRKWLAELGNVRKQKCKKRTQEENF
Download sequence
Identical sequences T1DVP2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]