SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1E5L0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1E5L0
Domain Number 1 Region: 1-135
Classification Level Classification E-value
Superfamily Hypothetical protein c14orf129, hspc210 7.06e-44
Family Hypothetical protein c14orf129, hspc210 0.00000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T1E5L0
Sequence length 137
Comment (tr|T1E5L0|T1E5L0_CROHD) GSK3-beta interaction protein-like protein {ECO:0000313|EMBL:JAA96908.1} OX=35024 OS=Crotalus horridus (Timber rattlesnake). GN= OC=Toxicofera; Serpentes; Colubroidea; Viperidae; Crotalinae; Crotalus.
Sequence
METDYNSMDESNNSETENQSEFKDFEDVKDMRIEAEAVVNDVLFAVSNMFVSKSLPCVED
VAYINVETREKNRYCLELTEAGLRVVAYDFDQVDDSLQNPYHETVYSLLDSVSPAYREAF
GNALLQRLEALESDGQS
Download sequence
Identical sequences A0A1W7RH02 J3SEH2 T1E5L0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]