SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1EFL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1EFL4
Domain Number 1 Region: 9-74,119-378,479-540
Classification Level Classification E-value
Superfamily MFS general substrate transporter 6.41e-33
Family Glycerol-3-phosphate transporter 0.074
Further Details:      
 
Weak hits

Sequence:  T1EFL4
Domain Number - Region: 394-433
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00707
Family Ovomucoid domain III-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T1EFL4
Sequence length 645
Comment (tr|T1EFL4|T1EFL4_HELRO) Solute carrier organic anion transporter family member {ECO:0000256|RuleBase:RU362056} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_112693 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MTLSIYTNGVIRTIERRFSLSSFQTGMLNSSNDIIHICIVGFIGYFSRKYHKPRIMCATV
MFSSIAGFMMASPHFISFREDHQTRLHLLNDNKMKRLKYCSKSQNVSNSLSDSNCANTRR
HPAFYIFLAAQLISGIGSSGIFTLTLAYIDENAPKHRASLLIGVYMGMISFGPVFGLGLS
TLCLKLPENLFSTEEMIDPNDPTYIGCWWLGYLIAASLLAFFAVFMWFFPKKINEDKNSP
ADNPDFSKQIKGDECILYFLLLILVYFPKALKKLVTNKLYILNLCQIICNAYTIYGMYVN
LVRYIETHFNYPAYIGSIVAGHLLSVVSAVVGSVGGFLGGVLTSRLRLKMVGALKMILTC
SALFMCGITILLNLSCPQVDMDMTIGKTVAENHVINSCNVACDCTTRRNDYYPVCFNNSI
NYFSPCIAGCQGQANGTFTSCKCLRNSFLHNETSTITDPFFTGTTKPGYCIPKCGMLIPF
AVTLFFMSFISTVTRVPGVMTTFRLVDDEERPFALGMNSFGVNLLGFIPAPLIVGKLIDH
CCKLWQVTCSVTGACLLFDTSRLRKTLYGFTLVVEVINFSFFFALFMFVRKLPIGQLELT
ERRVNLEMTVTKEKDREDKNLNSENVPGDDGLKFNESKAENGEVL
Download sequence
Identical sequences T1EFL4
XP_009020480.1.102002 jgi|Helro1|112693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]