SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1EIX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1EIX6
Domain Number 1 Region: 2-47
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 6.02e-19
Family Cysteine-rich DNA binding domain, (DM domain) 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1EIX6
Sequence length 57
Comment (tr|T1EIX6|T1EIX6_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO08688.1, ECO:0000313|EnsemblMetazoa:HelroP138771} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_138771 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
RKPKCARCRNHGMVSWLKGHKRSCRYKDCECPKCSLIAERQRVMAAQVALKRQQAVE
Download sequence
Identical sequences T1EIX6
jgi|Helro1|138771 XP_009013212.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]