SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1ERB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1ERB4
Domain Number 1 Region: 17-147
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000196
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1ERB4
Sequence length 164
Comment (tr|T1ERB4|T1ERB4_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO02074.1, ECO:0000313|EnsemblMetazoa:HelroP161301} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_161301 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MNNLFVQPDISFDTDACNQSYSGRITNGVIKSFNYPFDYINNLSCTYKFYFSDAQYTTSK
KICFKTRRFDLERSIAYCTFDYLQIEDNKYCGRGLWQKGLYDPKQPTSSLWVNNLCWSLN
YVETFELKFVSDSSVVGAGFYFEYSIINNTTDFSHQYPDSKIDK
Download sequence
Identical sequences T1ERB4
XP_009019482.1.102002 jgi|Helro1|161301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]