SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1J304 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  T1J304
Domain Number - Region: 13-60
Classification Level Classification E-value
Superfamily Serum albumin-like 0.0479
Family Serum albumin-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1J304
Sequence length 86
Comment (tr|T1J304|T1J304_STRMM) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:SMAR007960-PA} KW=Complete proteome; Reference proteome OX=126957 OS=Strigamia maritima (European centipede) (Geophilus maritimus). GN= OC=Pleurostigmophora; Geophilomorpha; Linotaeniidae; Strigamia.
Sequence
MYKNYQTSQLSSWIILGQYCTNNESQFRTFTLCCSSSTTSSAFECSQICKTDNCNLPKPY
SDKMVSALQFSQQLRRWFYLLPKWKQ
Download sequence
Identical sequences T1J304
SMAR007960-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]