SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T2JSQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T2JSQ4
Domain Number 1 Region: 3-109
Classification Level Classification E-value
Superfamily XisI-like 1.44e-41
Family XisI-like 0.0000443
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T2JSQ4
Sequence length 110
Comment (tr|T2JSQ4|T2JSQ4_CROWT) Uncharacterized protein {ECO:0000313|EMBL:CCQ68081.1} KW=Complete proteome OX=1284629 OS=Crocosphaera watsonii WH 0402. GN=CWATWH0402_4783 OC=Aphanothecaceae; Crocosphaera.
Sequence
METITYQQLIKDIIENYAHKHPQDNDIETQIVCDTINNHYLLLYVGWQGEKQIYGCPIHV
DIKDNKFWIQRDLTEQGIASQLLESGVSKENIVLGFRSPFNRKFTDFATP
Download sequence
Identical sequences G5J9S3 Q4BZ74 T2I6L3 T2J1M1 T2JFR4 T2JSQ4
WP_007307058.1.10559 WP_007307058.1.26817 WP_007307058.1.54612 WP_007307058.1.82155 WP_007307058.1.94920 WP_007307058.1.98453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]