SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T5HUB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  T5HUB2
Domain Number - Region: 32-96
Classification Level Classification E-value
Superfamily Aerolisin/ETX pore-forming domain 0.012
Family ETX/MTX2 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T5HUB2
Sequence length 156
Comment (tr|T5HUB2|T5HUB2_RHOER) Uncharacterized protein {ECO:0000313|EMBL:EQM32595.1} KW=Complete proteome OX=1381122 OS=Rhodococcus erythropolis DN1. GN=N601_16725 OC=Rhodococcus.
Sequence
MKKTITGFIGACSLVALVACGSDGDKPTEVGTLTSSVSATTTASPTTSSEAPATSSESTT
EAPSVDASVPAEVPSDPNVSSALPRTYAQACSDVLRYLDAYQPAIDESGEEMGMTRESLA
NDMLTSIQAYPEWSSLSADEQAEVTRGFTAATAGSC
Download sequence
Identical sequences T5HUB2
WP_021333179.1.61677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]