SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U1HJI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  U1HJI9
Domain Number - Region: 46-116
Classification Level Classification E-value
Superfamily F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 0.0068
Family F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U1HJI9
Sequence length 161
Comment (tr|U1HJI9|U1HJI9_ENDPU) Uncharacterized protein {ECO:0000313|EMBL:ERF70400.1} KW=Complete proteome; Reference proteome OX=1263415 OS=fungus). GN=EPUS_05219 OC=Chaetothyriomycetidae; Verrucariales; Verrucariaceae; Endocarpon.
Sequence
MSSTPTSGPNHETAKLNYFKWTSLFLTEKPYQILMDTPDGCPSSNFEFEAAPAQTIQDLR
GRESEYSLDKNGFAVRRHLLDRLRMEDWTRETVERLYFQEVDRILREEVEDVVECVIFDW
RLRSSDSVDSGEALDLSDLAQYMRPIETVHIGEFHDLSCLD
Download sequence
Identical sequences U1HJI9
XP_007803967.1.83800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]