SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U1HNQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U1HNQ7
Domain Number 1 Region: 90-158
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000186
Family Calbindin D9K 0.037
Further Details:      
 
Weak hits

Sequence:  U1HNQ7
Domain Number - Region: 41-110
Classification Level Classification E-value
Superfamily IpaD-like 0.0575
Family IpaD-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U1HNQ7
Sequence length 275
Comment (tr|U1HNQ7|U1HNQ7_9BRAD) Ferredoxin {ECO:0000313|EMBL:ERF86066.1} KW=Complete proteome OX=1230476 OS=Bradyrhizobium sp. DFCI-1. GN=C207_00629 OC=Bradyrhizobiaceae; Bradyrhizobium.
Sequence
MLFAIGAASSAVDLLSSLMSSKSTTQTGSSTQGNQTTGLFDLSTATSTSSSTSGGSGAGT
PQISPQTMSALLDAQSQATASTGTASTSTTPTSRSDALKDLFSLIDADGNGQITKTEFEN
ALGAGGTNIAQADDVFSKLDKNGDGSVSLDEMSQALQGHKGGGHHHHHMESGSTDGSGSS
GGSGGSSSDPLMQALDGATSTSVTNSDGSTTTTTTYADGSKVSMTTPATASANSSANSSS
AGNKATSSYNFIEQLIQRQSQAISAQASSSLSVSA
Download sequence
Identical sequences U1HNQ7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]