SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U2CG40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  U2CG40
Domain Number - Region: 4-105
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 0.0405
Family Clostridium neurotoxins, "coiled-coil" domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U2CG40
Sequence length 151
Comment (tr|U2CG40|U2CG40_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:ERI89479.1} KW=Complete proteome; Reference proteome OX=1321778 OS=Clostridiales bacterium oral taxon 876 str. F0540. GN=HMPREF1982_04633 OC=Bacteria; Firmicutes; Clostridia; Clostridiales.
Sequence
MQPYYQDYYSNNYDSFYRSTEEDFIDTSFDETNTLERNINITKDIIEDITASIRKDSMHI
FKDIEGFITDTRLMDYMLAALITYICNNYYKYENVIDDATDGLVEELRRNLPWVFDILKV
FGITPKVVDKFLDDLIRSTVENLRKKMPANL
Download sequence
Identical sequences U2CG40

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]