SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U3JII1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3JII1
Domain Number 1 Region: 20-57
Classification Level Classification E-value
Superfamily Defensin-like 0.0000436
Family Defensin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U3JII1
Sequence length 65
Comment (tr|U3JII1|U3JII1_FICAL) Uncharacterized protein {ECO:0000313|Ensembl:ENSFALP00000002585} KW=Complete proteome; Reference proteome OX=59894 OS=Ficedula albicollis (Collared flycatcher) (Muscicapa albicollis). GN= OC=Ficedula.
Sequence
MGILVLVFIFISLAQHGGAQGPDSCNHGGGLCRVGSCVSGEYLAQYCFEPIILCCKNLPP
STTES
Download sequence
Identical sequences U3JII1
ENSFALP00000002585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]