SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U3V2D5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  U3V2D5
Domain Number - Region: 42-75
Classification Level Classification E-value
Superfamily NSP3A-like 0.0458
Family NSP3A-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U3V2D5
Sequence length 106
Comment (tr|U3V2D5|U3V2D5_CLODI) Uncharacterized protein {ECO:0000313|EMBL:CCK95249.1} KW=Complete proteome OX=1225722 OS=Clostridioides difficile E1. GN=BN165_1410016 OC=Peptostreptococcaceae; Clostridioides.
Sequence
MSSKYNVWNFNYEFLGLDSGDEKNNEVYYEIDLDEILNENYIDEDIDSDLDSDGNSILGE
LISEMDIDEDVSVDMTYQELEVDLEDLDSYIDEDIDSDIKGILDEI
Download sequence
Identical sequences A0A1R2EGG0 A0A2I2JZB3 D5Q758 D5S213 U3UGE1 U3V2D5 U3VC27
WP_003421530.1.11372 WP_003421530.1.13823 WP_003421530.1.17998 WP_003421530.1.21925 WP_003421530.1.21980 WP_003421530.1.22395 WP_003421530.1.27300 WP_003421530.1.29939 WP_003421530.1.32953 WP_003421530.1.33275 WP_003421530.1.40516 WP_003421530.1.46117 WP_003421530.1.48491 WP_003421530.1.49451 WP_003421530.1.50495 WP_003421530.1.51166 WP_003421530.1.52164 WP_003421530.1.53288 WP_003421530.1.62797 WP_003421530.1.63852 WP_003421530.1.70464 WP_003421530.1.79125 WP_003421530.1.79673 WP_003421530.1.80610 WP_003421530.1.83641 WP_003421530.1.84195 WP_003421530.1.84606 WP_003421530.1.97432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]