SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U4LTW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  U4LTW2
Domain Number - Region: 11-50
Classification Level Classification E-value
Superfamily Probable GTPase Der, C-terminal domain 0.0667
Family Probable GTPase Der, C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U4LTW2
Sequence length 63
Comment (tr|U4LTW2|U4LTW2_PYROM) Uncharacterized protein {ECO:0000313|EMBL:CCX31141.1} KW=Complete proteome; Reference proteome OX=1076935 OS=Pyronema omphalodes (strain CBS 100304) (Pyronema confluens). GN=PCON_10031 OC=Pezizales; Pyronemataceae; Pyronema.
Sequence
MPPFSSSSSYPLLLLLFIHSPQQPASQFSTSPPRTVRNNVFRLCDYPIFNQNFSFRSLRQ
KQA
Download sequence
Identical sequences U4LTW2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]