SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V1DQM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V1DQM3
Domain Number 1 Region: 52-182
Classification Level Classification E-value
Superfamily Ecotin, trypsin inhibitor 6.15e-52
Family Ecotin, trypsin inhibitor 0.0000724
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V1DQM3
Sequence length 183
Comment (tr|V1DQM3|V1DQM3_9GAMM) Ecotin {ECO:0000313|EMBL:ESE43325.1} KW=Complete proteome OX=1353536 OS=Shewanella decolorationis S12. GN=SHD_0010 OC=Shewanellaceae; Shewanella.
Sequence
MKLTQLSRLAAVPLVFTLLSVNAEAVSPPHPTGLNAPMISVLSMNANNYAPVEAVKMFPA
PKKGMVQHILTLPKLENEADYMVEIQIGQTQLVDCNKHGLNGQLKELTVDGWGYNYYQVD
EISAGPSTMMACFELAKKEAFVQIPGELTLRYDSRLPKVFYLPEGAELRFRTWKADSTYQ
YSK
Download sequence
Identical sequences V1DQM3
WP_023265263.1.77687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]