SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4A2B0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4A2B0
Domain Number 1 Region: 2-118
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.49e-39
Family Regulator of G-protein signaling, RGS 0.0000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V4A2B0
Sequence length 118
Comment (tr|V4A2B0|V4A2B0_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO90822.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_87845 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
AGWAVNFDKLLQDESGIAVFTEFLKKEFSEENIIFWTACKDYKNIIDEEYRKVKAKEIYE
RHISARASDPVNVDSAARLHTDKFIDTPNSIMFDLAQQQIFQLMKTDSYARFLKSELY
Download sequence
Identical sequences V4A2B0
XP_009058413.1.39240 jgi|Lotgi1|87845|gw1.41.153.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]