SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4JUB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  V4JUB8
Domain Number - Region: 25-86
Classification Level Classification E-value
Superfamily MTH889-like 0.0353
Family MTH889-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4JUB8
Sequence length 110
Comment (tr|V4JUB8|V4JUB8_9CREN) Uncharacterized protein {ECO:0000313|EMBL:ESQ20937.1} KW=Complete proteome OX=1410574 OS=uncultured Acidilobus sp. CIS. GN=CISAcid_09700 OC=Acidilobus; environmental samples.
Sequence
MSYVEVTKAGTGQIVKVSDTIKGEPVNVVFVDLYFRLPKVPEQCQASLKLPEVDVELCNV
RAEGCEIILLKTSKGVEAIGGLVISSAQAILRPEDAKELCERALSSIISS
Download sequence
Identical sequences V4JUB8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]