SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4LQ21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  V4LQ21
Domain Number - Region: 40-106
Classification Level Classification E-value
Superfamily BAH domain 0.0523
Family BAH domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V4LQ21
Sequence length 203
Comment (tr|V4LQ21|V4LQ21_EUTSA) Uncharacterized protein {ECO:0000313|EMBL:ESQ44552.1} KW=Complete proteome; Reference proteome OX=72664 OS=Eutrema salsugineum (Saltwater cress) (Sisymbrium salsugineum). GN=EUTSA_v10003484mg OC=Eutrema.
Sequence
MVLAVNARNADAQNQLRRRRVVEVESSNEESGGFSQRSDSNHDDRRRRRRDNHPRQQQHR
REEEFKVDFSVFQEPQKRTMTCFVHGLNEEIASKVELQSFWTLADVKKLAIKIEKQVKTG
KKPFTRSYNTVTSFNPKIASKGDASSSTKKEEKKPTATPTDLNCEEEDECPNRRVMTFQD
IQEIEEELKHDSLDLAVVDQNPQ
Download sequence
Identical sequences V4LQ21
Thhalv10003484m|PACid:20207910 XP_006403099.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]