SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V5E1G3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  V5E1G3
Domain Number - Region: 84-126
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.0523
Family Sigma4 domain 0.054
Further Details:      
 
Domain Number - Region: 15-100
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 0.0706
Family Clostridium neurotoxins, "coiled-coil" domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V5E1G3
Sequence length 147
Comment (tr|V5E1G3|V5E1G3_9LACO) Uncharacterized protein {ECO:0000313|EMBL:EST03991.1} KW=Complete proteome OX=1328863 OS=Lactobacillus crispatus EM-LC1. GN=Lc367_0681 OC=Lactobacillus.
Sequence
MKNINVRQTRCNTRDFLKNKLDHYLNYCNRKRESIYSLDVKNTKVDASLNTDLANQYVEI
FYSQKIVSCVADALNNCTQTTGKPYKKFLTDRYLHLLNMEDIAIKYSFSRSTATRMDNKA
LLEFADKFLFSQLMNQVSPVIDLHVYQ
Download sequence
Identical sequences V5E1G3
WP_023488060.1.55862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]