SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V5HC39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V5HC39
Domain Number 1 Region: 91-148
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000000281
Family SIAH, seven in absentia homolog 0.0088
Further Details:      
 
Domain Number 2 Region: 30-78
Classification Level Classification E-value
Superfamily RING/U-box 0.00000164
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Weak hits

Sequence:  V5HC39
Domain Number - Region: 166-254
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.0647
Family Fibrinogen coiled-coil and central regions 0.01
Further Details:      
 
Domain Number - Region: 279-317
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0912
Family Regulator of G-protein signaling, RGS 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V5HC39
Sequence length 332
Comment (tr|V5HC39|V5HC39_IXORI) Putative tnf receptor-associated factor 6 {ECO:0000313|EMBL:JAB81010.1} OX=34613 OS=Ixodes ricinus (Common tick). GN= OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MPPTCVPLSTEFIPGLDWRPLCFEHPLPLDKVCQVCAVLCKETVVLPCSHTLCDVCFESS
VNLGCVCPLDAANFDKDAVDKLRLRPGQLLKLSVSCWNAEHGCNFIGPVSELLDHFEKEC
SHHRASCPKCHQDVPRMGLVQHCVRDCDPTQGAEAPQPRVTLQGVQLREGLEKASAEIKQ
SITELKDSYYGLQASVNTVTDDLKHGPSSSIDSVSSRLAQLQRMQSDAIHREGELLEDLR
RSCADIKQTVSDLKNDFSRPQTSSGASKDDVKLGHSGKSEFLSRGAPCEVSKDSQSMEQT
QGALEKPRELTPMELRIRRREIMALIESSGSR
Download sequence
Identical sequences V5HC39

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]