SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V6SPY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  V6SPY1
Domain Number - Region: 48-115
Classification Level Classification E-value
Superfamily IpaD-like 0.0288
Family IpaD-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V6SPY1
Sequence length 191
Comment (tr|V6SPY1|V6SPY1_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:ESU28738.1} KW=Complete proteome OX=1341181 OS=Flavobacterium limnosediminis JC2902. GN=FLJC2902T_13320 OC=Flavobacteriaceae; Flavobacterium.
Sequence
MIKINKKTLLLFLVVISIIVFIFYNGEYIKKIDPTILTLISGSIGFIISKFIEDIKESKQ
RIYEEKRKYYTDLIRPFRELLKNTKTKNGNNTLNNKQIADAMDTAFDNILYASDDVIEKY
GRFRNNSTNEEVNGSKDSYKTLKLFAELLLAMRKDLGNKYTSLDEVHILRMFINMSETEE
ESYRRKFRSLK
Download sequence
Identical sequences V6SPY1
WP_023578974.1.33425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]