SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V7BWY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V7BWY1
Domain Number 1 Region: 9-121
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.4e-17
Family Txnl5-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V7BWY1
Sequence length 131
Comment (tr|V7BWY1|V7BWY1_PHAVU) Uncharacterized protein {ECO:0000313|EMBL:ESW21066.1} KW=Complete proteome; Reference proteome OX=3885 OS=Phaseolus vulgaris (Kidney bean) (French bean). GN=PHAVU_005G038700g OC=Phaseoleae; Phaseolus.
Sequence
MPLKLLEATVWNFDGVFEKFRSEAAKNKANLILFLADKDPATSLSWCPDCVRAEPVIYKK
LEASSDDIALLRAYVGDRKTWRNPKHPWRVEPRFMLTGVPTLIHWDNDTVKGRLEDYEAH
LENKIETLVEK
Download sequence
Identical sequences V7BWY1
Phvulv091000699m|PACid:23548739 XP_007149072.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]