SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V8IJB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  V8IJB8
Domain Number - Region: 18-58
Classification Level Classification E-value
Superfamily Fibritin 0.0294
Family Fibritin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V8IJB8
Sequence length 95
Comment (tr|V8IJB8|V8IJB8_9STRE) Uncharacterized protein {ECO:0000313|EMBL:ETE00324.1} KW=Complete proteome OX=1415761 OS=Streptococcus pseudopneumoniae 5247. GN=U753_05545 OC=Streptococcus.
Sequence
MKLSNLLLFAGAAAGSYLVTKNRQTITYEVLNTTDRVQAIKDDVDIIQNSLQIIDQQKEL
IKEYQEDLTYKFKVLEKDIQTRLAVIKETQETEDK
Download sequence
Identical sequences V8IJB8
WP_023940786.1.99761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]