SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V9D8Y3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9D8Y3
Domain Number 1 Region: 1-157
Classification Level Classification E-value
Superfamily MAL13P1.257-like 8.89e-58
Family MAL13P1.257-like 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V9D8Y3
Sequence length 160
Comment (tr|V9D8Y3|V9D8Y3_9EURO) Uncharacterized protein {ECO:0000313|EMBL:ETI23310.1} KW=Complete proteome OX=1279043 OS=Cladophialophora carrionii CBS 160.54. GN=G647_05110 OC=Cladophialophora.
Sequence
MLALTLSAELEGVTDLVPSDTAESPYYYTFKVQCTSCREIHANWVGVSRHEMNEQSGSRG
EANFVWKCKNCKRESSATIKAAPAKYEQHSPAKAKNLIEIDCRGLEFTDFKPDGEWEATG
VESGTKFHGIDLSEGEWFDYDEKAGEEVSIKDIKWAIRRA
Download sequence
Identical sequences V9D8Y3
XP_008727665.1.97232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]