SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V9EL67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  V9EL67
Domain Number - Region: 61-104
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 0.0209
Family TRADD, N-terminal domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V9EL67
Sequence length 185
Comment (tr|V9EL67|V9EL67_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETI39676.1} KW=Complete proteome; Reference proteome OX=1317065 OS=Phytophthora parasitica P1569. GN=F443_14745 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
METPPPSTSFRPPDEIVPDSQSSDNESQESMSRVRLYDEIVPDSQESTSPDNFSPPRKLL
RRRRAAWSVLRARLRDVMQQMRVLIFVHTSDPKLCLDIRLCAVMRWKKIGWMALLRTSDA
RASDLETNLQLLQTFTKEDLLQDNNIDSMLACIAAHVLCGHVREYRPLLAKLSAQRFQKL
NEVFD
Download sequence
Identical sequences V9EL67

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]