SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V9IL80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  V9IL80
Domain Number - Region: 24-72
Classification Level Classification E-value
Superfamily Staphylocoagulase 0.0732
Family Staphylocoagulase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V9IL80
Sequence length 89
Comment (tr|V9IL80|V9IL80_APICE) FGFR1 oncogene partner 2 {ECO:0000313|EMBL:AEY61888.1} OX=7461 OS=Apis cerana (Indian honeybee). GN=ACCB14461 OC=Apoidea; Apidae; Apis.
Sequence
MSLTFQQIILDAKKLVIKISDHENTADNLISEIESVCSQIANMKQYQEEVEILNTEAKQR
PHIQLISGIQREVKHLQELQAENKELKKH
Download sequence
Identical sequences V9IL80

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]