SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V9KST3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9KST3
Domain Number 1 Region: 167-317
Classification Level Classification E-value
Superfamily Functional domain of the splicing factor Prp18 2.48e-52
Family Functional domain of the splicing factor Prp18 0.00028
Further Details:      
 
Domain Number 2 Region: 74-130
Classification Level Classification E-value
Superfamily PRP4-like 0.00000000000000575
Family PRP4-like 0.0000601
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V9KST3
Sequence length 328
Comment (tr|V9KST3|V9KST3_CALMI) PRP18 pre-mRNA processing factor 18-like protein {ECO:0000313|EMBL:AFP01489.1} OX=7868 OS=Callorhinchus milii (Ghost shark). GN= OC=Holocephali; Chimaeriformes; Callorhinchidae; Callorhinchus.
Sequence
MDILKAEIAKKRKQLEEKELIGESKKYFKRSELAKKEEEAYMERCGYKVVEEESTGKVHS
NTSEEEKPSASNPVLELELAEEKLPMTLSRQEVIRRLRERGEPIRLFGESEYEAFQRLRK
IEILAPEVNKGLRNDLKAALDKIDQQYLNEIVVGQEPGEEEGQNDLKVHEENTTIEELEF
ILGVWAKDLNSREDYSKCSVQGKLASATHKQTESYLKPLFRKLRKKNLPQDIKESITDII
KFMLQREYVKANDAYLQMAIGNAPWPIGVTMVGIHARTGREKIFSKHVAHVLNDETQRKY
IQGLKRLMTVCQKQFTTDPSKCVEYNAL
Download sequence
Identical sequences V9KST3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]