SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V9L589 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9L589
Domain Number 1 Region: 49-161
Classification Level Classification E-value
Superfamily PH domain-like 5.38e-34
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000432
Further Details:      
 
Domain Number 2 Region: 258-340
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 6.8e-27
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000614
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V9L589
Sequence length 347
Comment (tr|V9L589|V9L589_CALMI) Wiskott-Aldrich syndrome protein-like protein {ECO:0000313|EMBL:AFP07160.1} OX=7868 OS=Callorhinchus milii (Ghost shark). GN= OC=Holocephali; Chimaeriformes; Callorhinchidae; Callorhinchus.
Sequence
TGPGSARGTREPGSERERGAGGGGPDMSRMRGQDNSPSTLLSEQENLALFGLLERKSTTL
ASAVCQLYLAVPGNASQWTKEYSGVVCFIKDNPRRSYFIRVYNLQEGKQLWEQELYNQFR
YCTPRPYFHTFTADECQAGLNFADDYEGEKFQAVIEEKIQQRHSRQEKRHNTGHHSTPDS
GKRQCVPLPPPPTGSGSHGPAAPMGATSIQNPEITSFRYRSMPTAAPAPSAPAPDKKGKK
SKQNAKKKLTKADIGVPSNFQHVSHVGWDPDNGFDVNQMDPDLKKFFNQAGITEEQLTDV
ETSKVIHDFLDSQGGLDAVKEVIRKQDAAPAPRPPARGALPQPPPGP
Download sequence
Identical sequences V9L589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]